PDB entry 4lmy

View 4lmy on RCSB PDB site
Description: Structure of GAS PerR-Zn-Zn
Class: Transcription
Keywords: Transcription Factor, Zinc Binding, Transcription
Deposited on 2013-07-11, released 2014-04-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxide stress regulator PerR, FUR family
    Species: Streptococcus pyogenes [TaxId:1138874]
    Gene: spf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4lmya_
  • Chain 'B':
    Compound: Peroxide stress regulator PerR, FUR family
    Species: Streptococcus pyogenes [TaxId:1138874]
    Gene: spf
    Database cross-references and differences (RAF-indexed):
    • Uniprot H8F5Y5 (0-154)
      • expression tag (155-156)
    Domains in SCOPe 2.04: d4lmyb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lmyA (A:)
    mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
    mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
    iakeaheqtgykvtripviaygicpdcqakdqpdflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmyA (A:)
    mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
    mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
    iakeaheqtgykvtripviaygicpdcqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lmyB (B:)
    mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
    mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
    iakeaheqtgykvtripviaygicpdcqakdqpdflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmyB (B:)
    mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
    mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
    iakeaheqtgykvtripviaygicpdcqakdqpdfle