PDB entry 4lmq

View 4lmq on RCSB PDB site
Description: Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12
Class: cell adhesion/immune system
Keywords: immunoglobulin, cell adhesion-immune system complex
Deposited on 2013-07-10, released 2013-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.255
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1, SDF1A, SDF1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4lmqd_
  • Chain 'E':
    Compound: immunoglobulin G1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMQ (0-End)
  • Chain 'F':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1, SDF1A, SDF1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4lmqf_
  • Chain 'H':
    Compound: immunoglobulin G1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMQ (0-End)
  • Chain 'I':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1, SDF1A, SDF1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMQ (0-213)
    Domains in SCOPe 2.04: d4lmqi1, d4lmqi2
  • Chain 'L':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1, SDF1A, SDF1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMQ (0-213)
    Domains in SCOPe 2.04: d4lmql1, d4lmql2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lmqD (D:)
    rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylekaln
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmqD (D:)
    crffeshvaranvkhlkilntplqivarlknnnrqvcidpklkwiqeylekalnk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lmqF (F:)
    rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylekaln
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmqF (F:)
    rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeyleka
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lmqI (I:)
    diqmtqspsslsasvgdrvtitcrasesisyslswyqqkpgkapklliynavklesgvps
    rfsgsgsgtdftltisslqpedfatyyckqywntpftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lmqL (L:)
    diqmtqspsslsasvgdrvtitcrasesisyslswyqqkpgkapklliynavklesgvps
    rfsgsgsgtdftltisslqpedfatyyckqywntpftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec