PDB entry 4lmm

View 4lmm on RCSB PDB site
Description: Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21 space group
Class: protein binding
Keywords: CXCR2, NHERF1, Neutrophil, Inflammatory diseases, PROTEIN BINDING
Deposited on 2013-07-10, released 2014-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.19
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF1
    Species: Homo sapiens [TaxId:9606]
    Gene: NHERF, NHERF1, SLC9A3R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14745 (2-85)
      • expression tag (0-1)
      • see remark 999 (86-90)
    Domains in SCOPe 2.08: d4lmma1, d4lmma2, d4lmma3
  • Heterogens: ACY, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lmmA (A:)
gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpetsttl