PDB entry 4llu

View 4llu on RCSB PDB site
Description: Structure of Pertuzumab Fab with light chain Clambda at 2.16A
Class: immune system
Keywords: Fab, IMMUNE SYSTEM
Deposited on 2013-07-09, released 2014-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pertuzumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LLU (0-End)
  • Chain 'B':
    Compound: Light chain CLAMBDA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LLU (0-End)
    Domains in SCOPe 2.03: d4llub1, d4llub2
  • Chain 'C':
    Compound: Pertuzumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LLU (0-End)
  • Chain 'D':
    Compound: Light chain CLAMBDA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LLU (0-End)
    Domains in SCOPe 2.03: d4llud1, d4llud2
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lluB (B:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveikgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lluB (B:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveikgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lluD (D:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveikgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lluD (D:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveipkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap