PDB entry 4llt

View 4llt on RCSB PDB site
Description: Crystal structure of a farnesyl diphosphate synthase from Roseobacter denitrificans OCh 114, target EFI-509393, with two IPP and calcium bound in active site
Class: transferase
Keywords: Structural Genomics, Enzyme Function Initiative, polyprenyl synthetase, TRANSFERASE
Deposited on 2013-07-09, released 2013-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: ispA, RD1_0549
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16CN9 (22-310)
      • expression tag (11-21)
    Domains in SCOPe 2.06: d4llta1, d4llta2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: ispA, RD1_0549
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16CN9 (22-310)
      • expression tag (21)
    Domains in SCOPe 2.06: d4lltb1, d4lltb2
  • Heterogens: IPE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lltA (A:)
    mhhhhhhssgvdlgtenlyfqsmftqrldaaaaavqahfdkvlaafeplpiveamahats
    ggkrlrgflvletarlhdiaageaiwsataiealhayslvhddlpcmdnddmrrgqptvh
    kkwddatavlagdalqtlafelvthpgasasaevradlalslarasgaqgmvlgqaldia
    aetaraplsldeitrlqqgktgaligwsaqagarlaqadtaalkryaqalglafqiaddi
    ldvtgdsaqvgkavgkdasagkatfvsllgldaararamslideacdslatygakadtlr
    etarfvvrrth
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lltA (A:)
    dlgtenlyfqsmftqrldaaaaavqahfdkvlaafeplpiveamahatsggkrlrgflvl
    etarlhdiaageaiwsataiealhayslvhddlpcmdnddmrrgqptvhkkwddatavla
    gdalqtlafelvthpgasasaevradlalslarasgaqgmvlgqaldiaaetaraplsld
    eitrlqqgktgaligwsaqagarlaqadtaalkryaqalglafqiaddildvtgdsaqvg
    kavgkdasagkatfvsllgldaararamslideacdslatygakadtlretarfvvrrth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lltB (B:)
    mhhhhhhssgvdlgtenlyfqsmftqrldaaaaavqahfdkvlaafeplpiveamahats
    ggkrlrgflvletarlhdiaageaiwsataiealhayslvhddlpcmdnddmrrgqptvh
    kkwddatavlagdalqtlafelvthpgasasaevradlalslarasgaqgmvlgqaldia
    aetaraplsldeitrlqqgktgaligwsaqagarlaqadtaalkryaqalglafqiaddi
    ldvtgdsaqvgkavgkdasagkatfvsllgldaararamslideacdslatygakadtlr
    etarfvvrrth
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lltB (B:)
    smftqrldaaaaavqahfdkvlaafeplpiveamahatsggkrlrgflvletarlhdiaa
    geaiwsataiealhayslvhddlpcmdnddmrrgqptvhkkwddatavlagdalqtlafe
    lvthpgasasaevradlalslarasgaqgmvlgqaldiaaetaraplsldeitrlqqgkt
    galigwsaqagarlaqadtaalkryaqalglafqiaddildvtgdsaqvgkavgkdasag
    katfvsllgldaararamslideacdslatygakadtlretarfvvrrth