PDB entry 4lld
View 4lld on RCSB PDB site
Description: Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain lambda constant domain (IgG1 CH1:Clambda) at 1.19A
Class: immune system
Keywords: IgG domain, fragment of antibody, IMMUNE SYSTEM
Deposited on
2013-07-09, released
2014-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated
2014-01-29, with a file datestamp of
2014-01-24.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.146
AEROSPACI score: 0.76
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ig gamma-1 chain C region
Species: Homo sapiens [TaxId:9606]
Gene: IGHG1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Ig lambda-2 chain C regions
Species: Homo sapiens [TaxId:9606]
Gene: IGLC2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d4lldb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4lldB (B:)
gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapteclesgketaaakferq
hmdsstsaa
Sequence, based on observed residues (ATOM records): (download)
>4lldB (B:)
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap