PDB entry 4ll4

View 4ll4 on RCSB PDB site
Description: The structure of the TRX and TXNIP complex
Class: antitumor protein/protein binding
Keywords: Arrestin-like domain, ANTITUMOR PROTEIN-PROTEIN BINDING complex
Deposited on 2013-07-09, released 2014-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TXNIP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3M7
      • engineered mutation (167)
      • engineered mutation (202)
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: trx
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d4ll4b_
  • Chain 'C':
    Compound: Thioredoxin-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TXNIP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3M7
      • engineered mutation (167)
      • engineered mutation (202)
      • engineered mutation (264)
  • Chain 'D':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: trx
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d4ll4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ll4B (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ll4D (D:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv