PDB entry 4ljm

View 4ljm on RCSB PDB site
Description: Crystal structure of C-terminal RNA recognition motif of human ETR3
Class: RNA binding protein
Keywords: RRM, RNA binding, RNA, RNA binding protein, CELF family
Deposited on 2013-07-05, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.184
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUGBP Elav-like family member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CELF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ljma_
  • Chain 'B':
    Compound: CUGBP Elav-like family member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CELF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ljmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ljmA (A:)
    gshmqkegpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsy
    dnpvsaqaaiqamngfqigmkrlkvqlkrskndskpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ljmA (A:)
    gpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsaq
    aaiqamngfqigmkrlkvqlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ljmB (B:)
    gshmqkegpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsy
    dnpvsaqaaiqamngfqigmkrlkvqlkrskndskpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ljmB (B:)
    gpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsaq
    aaiqamngfqigmkrlkvqlk