PDB entry 4lir

View 4lir on RCSB PDB site
Description: Crystal structure of a nucleoporin 35kDa (NUP35) from Homo sapiens at 2.46 A resolution
Class: transport protein, nuclear protein
Keywords: PF05172 family, Nup53/35/40-type RNA recognition motif, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, TRANSPORT PROTEIN, NUCLEAR PROTEIN
Deposited on 2013-07-03, released 2013-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoporin NUP53
    Species: Homo sapiens [TaxId:9606]
    Gene: BC047029, MP44, NUP35, NUP53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lira_
  • Chain 'B':
    Compound: Nucleoporin NUP53
    Species: Homo sapiens [TaxId:9606]
    Gene: BC047029, MP44, NUP35, NUP53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lirb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lirA (A:)
    gspaqldpfytqgdsltsedhlddswvtvfgfpqasasyillqfaqygnilkhvmsntgn
    wmhiryqsklqarkalskdgrifgesimigvkpcidksvmessdrcalsspslaftp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lirA (A:)
    lddswvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgr
    ifgesimigvkpcidksvme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lirB (B:)
    gspaqldpfytqgdsltsedhlddswvtvfgfpqasasyillqfaqygnilkhvmsntgn
    wmhiryqsklqarkalskdgrifgesimigvkpcidksvmessdrcalsspslaftp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lirB (B:)
    dhlddswvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskd
    grifgesimigvkpcidksvmess