PDB entry 4liq

View 4liq on RCSB PDB site
Description: Structure of the extracellular domain of human CSF-1 receptor in complex with the Fab fragment of RG7155
Class: immune system
Keywords: CSF-1 receptor, receptor tyrosine kinase, antibody, fab fragment, IgG like domain, IMMUNE SYSTEM
Deposited on 2013-07-03, released 2014-06-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.189
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab fragment RG7155 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LIQ (0-End)
  • Chain 'L':
    Compound: Fab fragment RG7155 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LIQ (0-212)
    Domains in SCOPe 2.06: d4liql1, d4liql2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4liqL (L:)
    diqmtqspsslsasvgdrvtitcrasedvntyvswyqqkpgkapklliyaasnrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqsfsyptfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec