PDB entry 4lih

View 4lih on RCSB PDB site
Description: The crystal structure of Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase from Burkholderia cenocepacia J2315
Class: oxidoreductase
Keywords: Seattle Structural Genomics Center for Infectious Diseases, NIAID, National Institute of Allergy and Infectious Diseases, SSGCID, aldehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2013-07-02, released 2013-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4liha_
  • Chain 'B':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihb_
  • Chain 'C':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihc_
  • Chain 'D':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihd_
  • Chain 'E':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihe_
  • Chain 'F':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihf_
  • Chain 'G':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihg_
  • Chain 'H':
    Compound: Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: puuC, BceJ2315_05990, BCAL0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lihh_
  • Heterogens: MES, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lihA (A:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihA (A:)
    kltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaa
    vaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvp
    gaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpal
    aagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaft
    gstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemct
    agsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrge
    grlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandt
    eyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhal
    ekytelkstlirlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lihB (B:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihB (B:)
    ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav
    aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg
    aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala
    agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg
    stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta
    gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg
    rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte
    yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale
    kytelkstlirlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lihC (C:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihC (C:)
    ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav
    aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg
    aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala
    agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg
    stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta
    gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg
    rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte
    yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale
    kytelkstlirlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lihD (D:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihD (D:)
    kltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaa
    vaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvp
    gaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpal
    aagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaft
    gstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemct
    agsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrge
    grlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandt
    eyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhal
    ekytelkstlirlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4lihE (E:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihE (E:)
    ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav
    aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg
    aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala
    agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg
    stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta
    gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg
    rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte
    yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale
    kytelkstlirlr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lihF (F:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihF (F:)
    ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav
    aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg
    aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala
    agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg
    stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta
    gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg
    rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte
    yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale
    kytelkstlirlr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4lihG (G:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihG (G:)
    ltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaav
    aaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvpg
    aaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpala
    agnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaftg
    stavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemcta
    gsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrgeg
    rlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandte
    yglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhale
    kytelkstlirlr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4lihH (H:)
    mahhhhhhmnkltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakva
    dcgeadvnaavaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkp
    igdtttvdvpgaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpil
    maawkfgpalaagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllal
    hrdvdciaftgstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaaga
    ifynmgemctagsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlerv
    lgyieagrgegrlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddv
    deavriandteyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsg
    ngrdkslhalekytelkstlirlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lihH (H:)
    kltladwqhkaasleiegrafidgasrdahggrtfdcvspidgrvlakvadcgeadvnaa
    vaaarrafdagvwaglnprarkavllrwaalmrehldelslletldagkpigdtttvdvp
    gaaycvewfaeaidkvggevapadhhlvglvtrepvgvvaavvpwnfpilmaawkfgpal
    aagnsvvlkpsekspltairvaqlafeagipagvfnvvpgagepgkllalhrdvdciaft
    gstavgklimqyaaqsnlkrawlelggkspnivlpdcpdldraaqtaagaifynmgemct
    agsrllvhrdikdafieklvaaarayvpgnpldpsvsmgaivdgiqlervlgyieagrge
    grlvtggarvnaetggfyveptvfevkpdakiareeifgpvlsvivfddvdeavriandt
    eyglaaavwtsnlttahdvsrrlragtvwvncydeggdmnfpfggykqsgngrdkslhal
    ekytelkstlirlr