PDB entry 4lhx

View 4lhx on RCSB PDB site
Description: Crystal structure of nucleotide-free Rab8:Rabin8
Class: protein transport
Keywords: Small GTPase, Guanine Nucleotide Exchange Factor, PROTEIN TRANSPORT
Deposited on 2013-07-01, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.265
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lhxa_
  • Chain 'B':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lhxb_
  • Chain 'C':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB3IP, RABIN8
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB3IP, RABIN8
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB3IP, RABIN8
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB3IP, RABIN8
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lhxA (A:)
    ghmaktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkrik
    lqiwdtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmi
    lgnkcdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkkle
    gnspqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhxA (A:)
    ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lhxB (B:)
    ghmaktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkrik
    lqiwdtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmi
    lgnkcdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkkle
    gnspqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhxB (B:)
    ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkkl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.