PDB entry 4lh3

View 4lh3 on RCSB PDB site
Description: Structure of mouse 1-Pyrroline-5-Carboxylate Dehydrogenase (ALDH4A1) complexed with glutarate
Class: oxidoreductase
Keywords: Proline catabolism Substrate recognition, Rossmann Fold, OXIDOREDUCTASE
Deposited on 2013-06-30, released 2013-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: Aldh4a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CHT0 (Start-562)
      • conflict (32)
      • conflict (60)
      • conflict (467)
    Domains in SCOPe 2.06: d4lh3a_
  • Chain 'B':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: Aldh4a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CHT0 (21-562)
      • expression tag (18-20)
      • conflict (32)
      • conflict (60)
      • conflict (467)
    Domains in SCOPe 2.06: d4lh3b1, d4lh3b2
  • Heterogens: 1PE, GUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lh3A (A:)
    mgsshhhhhhssglvprgshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgq
    teaipcvvgdeevwtsdiqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkp
    madraqvflkaadmlsgprraevlaktmvgqgktviqaeidaaaelidffrfnakfavel
    egeqpisvppstnhtvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtaml
    asyavyrilreaglppniiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaq
    nldrfrtfprlagecggknfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpksl
    wpqikgrlleehsrikvgdpaedfgtffsavidakafarikkwleharsspslsilaggq
    cnesvgyyvepciieskdpqepimkeeifgpvltvyvypddkyretlklvdsttsygltg
    avfaqdkaivqeatrmlrnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilr
    wtspqvikethkplgdwrysymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lh3A (A:)
    kvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyqlspfnhahk
    vakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprraevlaktmvg
    qgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrglegfvaaispf
    nftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgptfg
    dtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggknfhfvhssadvd
    svvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgdpaedfgtffsa
    vidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqepimkeeifg
    pvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaagnfyindks
    tgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysymq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lh3B (B:)
    mgsshhhhhhssglvprgshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgq
    teaipcvvgdeevwtsdiqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkp
    madraqvflkaadmlsgprraevlaktmvgqgktviqaeidaaaelidffrfnakfavel
    egeqpisvppstnhtvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtaml
    asyavyrilreaglppniiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaq
    nldrfrtfprlagecggknfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpksl
    wpqikgrlleehsrikvgdpaedfgtffsavidakafarikkwleharsspslsilaggq
    cnesvgyyvepciieskdpqepimkeeifgpvltvyvypddkyretlklvdsttsygltg
    avfaqdkaivqeatrmlrnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilr
    wtspqvikethkplgdwrysymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lh3B (B:)
    shmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdi
    qyqlspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgp
    rraevlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyr
    glegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppni
    iqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggk
    nfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvg
    dpaedfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskd
    pqepimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlr
    naagnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwr
    ysymq