PDB entry 4lgm

View 4lgm on RCSB PDB site
Description: Crystal Structure of Sulfolobus solfataricus Vps4
Class: hydrolase
Keywords: ATP hydrolysis, HYDROLASE
Deposited on 2013-06-28, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vps4 AAA ATPase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: SSO0909
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZJ7
      • engineered mutation (128)
    Domains in SCOPe 2.07: d4lgma_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lgmA (A:)
    gpidpftntsppeevvitekpkvsfkdivglddvkealreaiiyptkrpdlfplgwprgi
    llygppgcgktmiaaavaneidsifmqldaasvmskwlgeaeknvanvfkmareeskkqn
    kpaiifidqldallgvystevggearvrnqflkemdglldksenykvyvigatnkpwrld
    eaflrrfqkriyvplpdyeqrlslfkyytskikldtevsleelakltegytasdirdivq
    aahikvvkemfknnlgeprtitlqdfkdilkvrmpsvnpelikayeawtekfkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lgmA (A:)
    kvsfkdivglddvkealreaiiyptkrpdlfplgwprgillygppgcgktmiaaavanei
    dsifmqldaasvmsgeaeknvanvfkmareeskkqnkpaiifidqldallarvrnqflke
    mdgllvyvigatnkpwrldeaflrrfqkriyvplpdyeqrlslfkyytskikldtevsle
    elakltegytasdirdivqaahikvvkemfknnlgeprtitlqdfkdilkvrmpsvnpel
    ikayeawtekf