PDB entry 4lgg

View 4lgg on RCSB PDB site
Description: Structure of 3MB-PP1 bound to analog-sensitive Src kinase
Class: transferase/transferase inhibitor
Keywords: Kinase Domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-06-27, released 2013-08-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.238
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (0-269)
      • engineered mutation (74)
    Domains in SCOPe 2.03: d4lgga_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (0-269)
      • engineered mutation (74)
    Domains in SCOPe 2.03: d4lggb_
  • Heterogens: VGG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lggA (A:)
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdp
    eerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lggA (A:)
    reslrlevklgqggevwmgtwngttrvaiktlkpglqeaqvmkklrheklvqlyavvsee
    iyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraanil
    vgenlvckvadfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevl
    dqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgen
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lggB (B:)
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdp
    eerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lggB (B:)
    reslrlevklggevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklvqlya
    vvseeyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlra
    anilvgenlvckvadfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvn
    revldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyq
    pgenl