PDB entry 4lfe

View 4lfe on RCSB PDB site
Description: Crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, partially liganded complex;
Class: transferase
Keywords: isoprenoid synthase, enzyme function initiative, efi, transferase
Deposited on 2013-06-26, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl diphosphate synthase
    Species: Streptococcus uberis [TaxId:218495]
    Gene: fps, SUB1274
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9DUT7 (1-289)
      • expression tag (0)
    Domains in SCOPe 2.07: d4lfea1, d4lfea2
  • Chain 'B':
    Compound: Geranylgeranyl diphosphate synthase
    Species: Streptococcus uberis [TaxId:218495]
    Gene: fps, SUB1274
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lfeb_
  • Heterogens: IPE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lfeA (A:)
    smdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltes
    hfkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgml
    aetdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllay
    pfwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmt
    yphllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lfeA (A:)
    smdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltes
    hfkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgml
    aetdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllay
    pfwaaarvaqldenllatfleigmiiglafqvrddilditakmtyphllglnesyqilde
    sldqaeailrklsdeiafapqkilslierlrlda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lfeB (B:)
    smdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltes
    hfkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgml
    aetdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllay
    pfwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmt
    yphllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lfeB (B:)
    dklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqiplteshf
    kaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmlae
    tdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllaypf
    waaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmtyp
    hllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda