PDB entry 4lf3

View 4lf3 on RCSB PDB site
Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor
Class: immune system
Keywords: Fab fragment, GCGR, IMMUNE SYSTEM
Deposited on 2013-06-26, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.212
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fab heavy chain
  Species: Mus musculus [TaxId:10090]
  Gene: Anti GCGR mAb
  Database cross-references and differences (RAF-indexed):
  • PDB 4LF3 (0-213)
  Domains in SCOPe 2.06: d4lf3a1, d4lf3a2
• Chain 'B':
  Compound: Fab light chain
  Species: Mus musculus [TaxId:10090]
  Gene: Anti GCGR mAb
  Database cross-references and differences (RAF-indexed):
  • PDB 4LF3 (0-230)
• Chain 'C':
  Compound: Glucagon receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: GCGR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P47871 (0-94)
    • engineered mutation (11)
• Chain 'D':
  Compound: Fab heavy chain
  Species: Mus musculus [TaxId:10090]
  Gene: Anti GCGR mAb
  Database cross-references and differences (RAF-indexed):
  • PDB 4LF3 (0-213)
  Domains in SCOPe 2.06: d4lf3d1, d4lf3d2
• Chain 'E':
  Compound: Fab light chain
  Species: Mus musculus [TaxId:10090]
  Gene: Anti GCGR mAb
  Database cross-references and differences (RAF-indexed):
  • PDB 4LF3 (0-230)
• Chain 'F':
  Compound: Glucagon receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: GCGR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P47871 (Start-94)
    • engineered mutation (11)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lf3A (A:)
  diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
  rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lf3D (D:)
  diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
  rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.