PDB entry 4lf3

View 4lf3 on RCSB PDB site
Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor
Class: immune system
Keywords: Fab fragment, GCGR, IMMUNE SYSTEM
Deposited on 2013-06-26, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.212
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Anti GCGR mAb
    Database cross-references and differences (RAF-indexed):
    • PDB 4LF3 (0-213)
    Domains in SCOPe 2.07: d4lf3a1, d4lf3a2
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene: Anti GCGR mAb
    Database cross-references and differences (RAF-indexed):
    • PDB 4LF3 (0-230)
  • Chain 'C':
    Compound: Glucagon receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GCGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47871 (0-94)
      • engineered mutation (11)
  • Chain 'D':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Anti GCGR mAb
    Database cross-references and differences (RAF-indexed):
    • PDB 4LF3 (0-213)
    Domains in SCOPe 2.07: d4lf3d1, d4lf3d2
  • Chain 'E':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene: Anti GCGR mAb
    Database cross-references and differences (RAF-indexed):
    • PDB 4LF3 (0-230)
  • Chain 'F':
    Compound: Glucagon receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GCGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47871 (Start-94)
      • engineered mutation (11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lf3A (A:)
    diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
    rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lf3D (D:)
    diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
    rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.