PDB entry 4lex

View 4lex on RCSB PDB site
Description: Unliganded crystal structure of mAb7
Class: immune system
Keywords: Fab fragment, anti-GCGR, Fab heavy and light chain, Antibody, IMMUNE SYSTEM
Deposited on 2013-06-26, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.187
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LEX (0-216)
  • Chain 'L':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LEX (0-216)
    Domains in SCOPe 2.06: d4lexl1, d4lexl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lexL (L:)
    divmtqtplslpvtpgqpasiscrssqslvhsngntylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg