PDB entry 4lem

View 4lem on RCSB PDB site
Description: Crystal structure of the Delta-pyrroline-5-carboxylate dehydrogenase from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: Rossmann fold, dehydrogenase, oxidoreductase
Deposited on 2013-06-26, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50443 (20-End)
      • expression tag (19)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4lema1, d4lema2
  • Chain 'B':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50443 (20-End)
      • expression tag (19)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4lemb1, d4lemb2
  • Chain 'C':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50443 (20-562)
      • expression tag (19)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4lemc1, d4lemc2
  • Chain 'D':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50443 (20-562)
      • expression tag (19)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4lemd1, d4lemd2
  • Chain 'E':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50443 (20-End)
      • expression tag (19)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4leme1, d4leme2
  • Chain 'F':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50443 (20-End)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4lemf_
  • Heterogens: B12, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lemA (A:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lemA (A:)
    hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
    vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
    ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
    dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
    lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
    vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
    tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
    esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa
    gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph
    ma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lemB (B:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lemB (B:)
    hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
    vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
    ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
    dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
    lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
    vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
    tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
    esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa
    gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph
    mav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lemC (C:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lemC (C:)
    hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
    vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
    ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
    dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
    lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
    vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
    tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
    esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa
    gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph
    mavd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lemD (D:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lemD (D:)
    hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
    vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
    ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
    dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
    lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
    vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
    tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
    esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa
    gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph
    mavd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4lemE (E:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lemE (E:)
    hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
    vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
    ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
    dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
    lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
    vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
    tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
    esfvieyfgpllsvhvypderyeqildvidtgyaltgaviaddrqavltaldrlrfaagn
    fyvndkptavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphmav
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lemF (F:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lemF (F:)
    mdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgeridv
    vqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwre
    kiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpld
    gfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvinl
    vtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdfv
    vahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdit
    dlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddpsfv
    ieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaagnfy
    vndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphma