PDB entry 4leg

View 4leg on RCSB PDB site
Description: Human cathepsin K mutant C25S in complex with an allosteric modifier
Class: hydrolase
Keywords: papain-like cysteine peptidase, PROTEASE, THIOL PROTEASE, HYDROLASE
Deposited on 2013-06-25, released 2014-02-12
Made obsolete by 5j94 on 2016-04-20

The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.266
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (0-222)
      • engineered mutation (32)
    Domains in SCOPe 2.06: d4lega_
  • Heterogens: 1XF, SO4, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4legA (A:)
    yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
    lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
    ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
    kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm