PDB entry 4le2

View 4le2 on RCSB PDB site
Description: Crystal structure of the unphosphorylated receiver domain of DesR in the active state
Class: DNA binding protein
Keywords: Response regulator, two-component system, transcription factor, receiver domain, DNA BINDING PROTEIN
Deposited on 2013-06-25, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4le2a_
  • Chain 'B':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34723 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d4le2b1, d4le2b2
  • Chain 'C':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34723 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4le2c1, d4le2c2
  • Chain 'D':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34723 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d4le2d1, d4le2d2
  • Heterogens: PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4le2A (A:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le2A (A:)
    misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
    tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
    riyapelmedly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4le2B (B:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le2B (B:)
    gsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiemp
    gktgleaaeelkdtgckiiilttfpgyfqraikagvkgyllkdspseelanairsvmngk
    riyapelmed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4le2C (C:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le2C (C:)
    sgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiem
    pgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvm
    ngkriyapelmedl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4le2D (D:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le2D (D:)
    smisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempg
    ktgleaaeelkdtgckiiilttfyfqraikagvkgyllkdspseelanairsvmngkriy
    apelme