PDB entry 4ldj

View 4ldj on RCSB PDB site
Description: Crystal Structure of a GDP-bound G12C Oncogenic Mutant of Human GTPase KRas
Class: hydrolase
Keywords: Small GTPase, GDP bound, oncogenic mutation, HYDROLASE
Deposited on 2013-06-24, released 2014-06-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.133
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.05: d4ldja_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ldjA (A:)
gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek