PDB entry 4ldf

View 4ldf on RCSB PDB site
Description: Crystal Structure of CpBRD2 from cryptosporidium, cgd3_3190
Class: transferase
Keywords: Structural Genomics Consortium, SGC, bromodomain, TRANSFERASE
Deposited on 2013-06-24, released 2013-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GCN5 like acetylase + bromodomain
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd3_3190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ldfa_
  • Chain 'B':
    Compound: GCN5 like acetylase + bromodomain
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd3_3190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ldfb_
  • Heterogens: GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ldfA (A:)
    gidpveqskvdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmk
    rkaknkeyktlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ldfA (A:)
    kvdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkey
    ktlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ldfB (B:)
    gidpveqskvdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmk
    rkaknkeyktlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ldfB (B:)
    vdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkeyk
    tlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe