PDB entry 4ld5

View 4ld5 on RCSB PDB site
Description: Crystal structure of MepR Q18P mutant from multidrug resistant S. aureus clinical isolate
Class: transcription
Keywords: multidrug resistance, winged helix-turn-helix, transcription repression, TRANSCRIPTION
Deposited on 2013-06-24, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (Start-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5a_
  • Chain 'B':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5b_
  • Chain 'C':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5c_
  • Chain 'D':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5d_
  • Chain 'E':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (Start-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5e_
  • Chain 'F':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5f_
  • Chain 'G':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5g_
  • Chain 'H':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4ld5h_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ld5A (A:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5A (A:)
    eftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ld5B (B:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5B (B:)
    meftysylfrmishemkpleqfditneqghtlgylyahqqdgltqndiakalqrtgptvs
    nllrnlerkkliyrykniglttsgiklveaftsifdemeqtlvsqlseeeneqmkanltk
    mlsslq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ld5C (C:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5C (C:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ld5D (D:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5D (D:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ld5E (E:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5E (E:)
    ftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
    tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
    eneqmkanltkmlsslq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ld5F (F:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5F (F:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ld5G (G:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5G (G:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ld5H (H:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ld5H (H:)
    meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq