PDB entry 4lci

View 4lci on RCSB PDB site
Description: Anti canine CD28 antibody, 1C6
Class: immune system
Keywords: Immunoglobulin, antibody, CD28, IMMUNE SYSTEM
Deposited on 2013-06-21, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti canine CD28 antibody, 1C6, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCI (0-119)
    Domains in SCOPe 2.08: d4lcih1, d4lcih2
  • Chain 'L':
    Compound: anti canine CD28 antibody, 1C6, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCI (0-116)
    Domains in SCOPe 2.08: d4lcil_
  • Heterogens: GOL, NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lciH (H:)
qiqlvqsgpelkkpgetvkisckasgytftnygmtwvkqaprkglkwmgwintytgrpty
addfkgrfafsletsastaylqinnlkhedtatyfcaslgedfwgqgttltvsshhhhhh

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lciL (L:)
mdivmtqaapsvpvtpgesvsiscrstksllhsngntylywflqrpgqspqrliyymsnl
asgvpdrfsgrgsgtdftlrisrveaedagvyycmqsleypytfgggtkleikrlvp