PDB entry 4lcb

View 4lcb on RCSB PDB site
Description: Structure of Vps4 homolog from Acidianus hospitalis
Class: protein transport
Keywords: ATPase, ATP hydrolysis, PROTEIN TRANSPORT
Deposited on 2013-06-21, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein CdvC, Vps4
    Species: Acidianus hospitalis [TaxId:933801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lcba_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lcbA (A:)
    gpmleemarkyaiaavradkegnrdeaityykkaidvltqivvlypdsptrqayeqmide
    ykkrvsvlenmlpetpqednsqktddelimkekpkvsfsdivglddvkealkeaiiypsk
    rpdlfplgwprgillygppgngktmlaaavaneidsyfihvdaasimskwlgeaeknvak
    ifntareyskkdnkpaiifvdeidallgtytsevggevrvrnqflkemdgimdknenymv
    yvigatnkpwrldepflrrfqkriyvplpdfnqrlalfkyytskvklgnvdlqelakmte
    gysasdirdivqsahmrvvkemfeknlsepreitmddfkevlkirkpsvnqellkayeaw
    tekfkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lcbA (A:)
    kvsfsdivglddvkealkeaiiypskrpdlfplgwprgillygppgngktmlaaavanei
    dsyfihvdaasimskgeaeknvakifntareyskkdnkpaiifvdeidallvrvrnqflk
    emdgimmvyvigatnkpwrldepflrrfqkriyvplpdfnqrlalfkyytskvklgnvdl
    qelakmtegysasdirdivqsahmrvvkemfeknlsepreitmddfkevlkirkpsvnqe
    llkayeawtekf