PDB entry 4lby

View 4lby on RCSB PDB site
Description: Identifying ligand binding hot spots in proteins using brominated fragments
Class: protein binding
Keywords: GTPase,, PROTEIN BINDING
Deposited on 2013-06-21, released 2013-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.158
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu-a
    Species: Thermus thermophilus [TaxId:274]
    Gene: tuf, tufA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-403)
      • conflict (262)
    Domains in SCOPe 2.06: d4lbya1, d4lbya2, d4lbya3
  • Heterogens: GNP, MG, NH4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lbyA (A:)
    kgefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargi
    tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil
    larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq
    mhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgr
    iergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreeverg
    qvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvem
    vmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lbyA (A:)
    fvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitin
    tahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillar
    qvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhr
    npktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgrier
    gkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergqvl
    akpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmp
    gdnvtftvelikpvaleeglrfaireggrtvgagvvtkile