PDB entry 4l9v

View 4l9v on RCSB PDB site
Description: Crystal structure of Se-Met derivative MepR F27L mutant from multidrug resistant S. aureus clinical isolate
Class: transcription
Keywords: winged helix-turn-helix, wHTH, transcription repressor, TRANSCRIPTION
Deposited on 2013-06-18, released 2013-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (0-138)
      • engineered mutation (26)
    Domains in SCOPe 2.06: d4l9va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l9vA (A:)
    meftysylfrmishemkqkadqkleqlditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l9vA (A:)
    meftysylfrmishemkqkadqkleqlditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
    eeeneqmkanltkmlsslq