PDB entry 4l9s

View 4l9s on RCSB PDB site
Description: Crystal Structure of H-Ras G12C, GDP-bound
Class: signaling protein
Keywords: GTPase, activating mutant, SIGNALING PROTEIN
Deposited on 2013-06-18, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.156
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (5-170)
      • engineered mutation (16)
    Domains in SCOPe 2.03: d4l9sa_
  • Heterogens: GDP, MG, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l9sA (A:)
    gamgsmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
    ldtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
    nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l9sA (A:)
    mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    rdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartves
    rqaqdlarsygipyietsaktrqgvedafytlvreirqh