PDB entry 4l8s

View 4l8s on RCSB PDB site
Description: Crystal structure of a human Valpha7.2/Vbeta13.3 MAIT TCR in complex with bovine MR1
Class: immune system
Keywords: Immunoglobulin domain, MHC-class I, Antigen presentation, Antigen recognition, Antigen, Cell membrane, IMMUNE SYSTEM
Deposited on 2013-06-17, released 2013-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.231
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muccosal Associated Invariant T Cell Receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L8S
    Domains in SCOPe 2.04: d4l8sa1, d4l8sa2
  • Chain 'B':
    Compound: Muccosal Associated Invariant T Cell Receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4L8S
    Domains in SCOPe 2.04: d4l8sb1, d4l8sb2
  • Chain 'C':
    Compound: Beta-2-microglobulin, MHC class I-related protein
    Species: Bos taurus [TaxId:9913]
    Gene: MR1, Bt.63045
    Database cross-references and differences (RAF-indexed):
    • Uniprot C1ITJ8 (113-End)
    • Uniprot P01888 (0-End)
      • linker (99-104)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l8sA (A:)
    magqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekg
    rfssflsrskgysylllkelqmkdsasylcasmdsnyqliwgagtkliikpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspessale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8sA (A:)
    nidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfss
    flsrskgysylllkelqmkdsasylcasmdsnyqliwgagtkliikpniqnpdpavyqlr
    dskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfac
    anafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l8sB (B:)
    managvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkg
    evpngynvsrlnkrefslrlesaapsqtsvyfcassetdpntgelffgegsrltvledlk
    nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplk
    eqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
    awgradsaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8sB (B:)
    agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
    ngynvsrlnkrefslrlesaapsqtsvyfcassetdpntgelffgegsrltvledlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    ra
    

  • Chain 'C':
    No sequence available.