PDB entry 4l8g

View 4l8g on RCSB PDB site
Description: Crystal Structure of K-Ras G12C, GDP-bound
Class: signaling protein
Keywords: GTPase, activating mutant, SIGNALING PROTEIN
Deposited on 2013-06-17, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.151
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS isoform 2B, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • variant (12)
      • see remark 999 (151)
      • see remark 999 (153)
      • see remark 999 (165-167)
    Domains in SCOPe 2.06: d4l8ga_
  • Heterogens: GDP, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l8gA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l8gA (A:)
    mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtaq
    ymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqa
    qdlarsygipfietsaktrqgvddafytlvreirkhk