PDB entry 4l85

View 4l85 on RCSB PDB site
Description: Crystal structure of receiver domain of KdpE D52A mutant from E. coli
Class: transcription
Keywords: Receiver domain, TRANSCRIPTION
Deposited on 2013-06-15, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KDP operon transcriptional regulatory protein kdpE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0694, JW5096, kdpE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21866 (4-End)
      • expression tag (0-3)
      • engineered mutation (53)
    Domains in SCOPe 2.07: d4l85a1, d4l85a2
  • Chain 'B':
    Compound: KDP operon transcriptional regulatory protein kdpE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0694, JW5096, kdpE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21866 (4-End)
      • expression tag (1-3)
      • engineered mutation (53)
    Domains in SCOPe 2.07: d4l85b1, d4l85b2
  • Chain 'C':
    Compound: KDP operon transcriptional regulatory protein kdpE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0694, JW5096, kdpE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21866 (4-End)
      • expression tag (0-3)
      • engineered mutation (53)
    Domains in SCOPe 2.07: d4l85c1, d4l85c2
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l85A (A:)
    gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdg
    dgiefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr
    hsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l85A (A:)
    gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalggief
    irdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l85B (B:)
    gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdg
    dgiefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr
    hsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l85B (B:)
    amanvlivedrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdgdgiefi
    rdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4l85C (C:)
    gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdg
    dgiefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr
    hsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l85C (C:)
    gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdg
    dgiefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr