PDB entry 4l7u

View 4l7u on RCSB PDB site
Description: Human artd3 (parp3) - catalytic domain in complex with inhibitor ME0398
Class: transferase/transferase inhibitor
Keywords: DIPHTHERIA TOXIN LIKE ADP-RIBOSE TRANSFERASE, TRANSFERASE, ADP-RIBOSYLATION, transferase-transferase inhibitor complex
Deposited on 2013-06-14, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.242
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT3, ADPRTL3, PARP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l7ua1, d4l7ua2
  • Heterogens: 1VC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l7uA (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l7uA (A:)
    krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
    ealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqalqa
    vseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwk
    vnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyfasens
    ksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarghtepdpt
    qdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh