PDB entry 4l7l

View 4l7l on RCSB PDB site
Description: Human artd3 (parp3) - catalytic domain in complex with inhibitor ME0368
Class: transferase/transferase inhibitor
Keywords: DIPHTHERIA TOXIN LIKE ADP-RIBOSE TRANSFERASE, TRANSFERASE, ADP-RIBOSYLATION, transferase-transferase inhibitor complex
Deposited on 2013-06-14, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ADPRT3, ADPRTL3, PARP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6F1 (2-356)
      • expression tag (1)
    Domains in SCOPe 2.07: d4l7la1, d4l7la2, d4l7la3
  • Heterogens: 1VA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l7lA (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l7lA (A:)
    mkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeal
    eealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqalq
    avseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiw
    kvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyfasen
    sksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarghtepdp
    tqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh