PDB entry 4l5n

View 4l5n on RCSB PDB site
Description: Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus phage PZA inhibitor protein p56
Class: hydrolase/hydrolase inhibitor
Keywords: UDG Inhibition, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-06-11, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.172
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Herpes simplex virus type 1 [TaxId:10299]
    Gene: UL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l5na_
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Herpes simplex virus type 1 [TaxId:10299]
    Gene: UL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l5nb_
  • Chain 'C':
    Compound: Early protein GP1B
    Species: Bacillus phage PZA [TaxId:10757]
    Gene: 1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Early protein GP1B
    Species: Bacillus phage PZA [TaxId:10757]
    Gene: 1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Early protein GP1B
    Species: Bacillus phage PZA [TaxId:10757]
    Gene: 1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Early protein GP1B
    Species: Bacillus phage PZA [TaxId:10757]
    Gene: 1B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l5nA (A:)
    stggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlp
    predvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavknc
    ypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpgl
    vfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidws
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l5nA (A:)
    pldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryc
    tpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcl
    ekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqna
    irpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l5nB (B:)
    stggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlp
    predvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavknc
    ypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpgl
    vfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidws
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l5nB (B:)
    dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
    devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
    wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
    pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.