PDB entry 4l50

View 4l50 on RCSB PDB site
Description: Crystal structures of the LsrR proteins complexed with phospho-AI-2 and its two different analogs reveal distinct mechanisms for ligand recognition
Class: transcription regulator
Keywords: DNA transcriptional regulator, Phospho-AI-2 binding, DNA binding, TRANSCRIPTION REGULATOR, removed helix-turn-helix domain, SorC/DeoR family
Deposited on 2013-06-10, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator LsrR
    Species: Escherichia coli [TaxId:83333]
    Gene: lsrR, ydeW, b1512, JW1505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l50a_
  • Chain 'B':
    Compound: Transcriptional regulator LsrR
    Species: Escherichia coli [TaxId:83333]
    Gene: lsrR, ydeW, b1512, JW1505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4l50b_
  • Heterogens: D8X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l50A (A:)
    skghqsgiirvqinsrfegcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlm
    sllqpqqmlaigfgeatmntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvni
    ipaplrassadiartlknencvkdvllaaqaadvaivgigavsqqddatiirsgyisqge
    qlmigrkgavgdilgyffdakgdvvtnikihneliglplsalktipvrvgvaggenkaea
    iaaamkggyinalvtdqdtaaailrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l50A (A:)
    fegcleyetqlrrqfslqhvrvipgladvggrlgigaahmlmsllqpqqmlaigfgeatm
    ntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlkn
    encvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyff
    dakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdqd
    taaailrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l50B (B:)
    skghqsgiirvqinsrfegcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlm
    sllqpqqmlaigfgeatmntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvni
    ipaplrassadiartlknencvkdvllaaqaadvaivgigavsqqddatiirsgyisqge
    qlmigrkgavgdilgyffdakgdvvtnikihneliglplsalktipvrvgvaggenkaea
    iaaamkggyinalvtdqdtaaailrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l50B (B:)
    egcleyetqlrrqfslqhvrvipgdadvggrlgigaahmlmsllqpqqmlaigfgeatmn
    tlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlkne
    ncvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyffd
    akgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdqdt
    aaailrs