PDB entry 4l4s

View 4l4s on RCSB PDB site
Description: Structural characterisation of the NADH binary complex of human lactate dehydrogenase M isozyme
Class: oxidoreductase
Keywords: Glycolysis, anaerobic respiration, OXIDOREDUCTASE
Deposited on 2013-06-09, released 2014-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.188
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l4sa1, d4l4sa2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l4sh1, d4l4sh2
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l4sA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l4sA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4l4sH (H:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l4sH (H:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf