PDB entry 4l4p

View 4l4p on RCSB PDB site
Description: the mutant(E139A) structure in complex with xylotriose
Class: Hydrolase
Keywords: GH10 family, xylanase, Hydrolase
Deposited on 2013-06-08, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Caldicellulosiruptor bescii [TaxId:521460]
    Gene: Athe_0185
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9MMA5 (Start-336)
      • engineered mutation (138)
    Domains in SCOPe 2.06: d4l4pa_
  • Heterogens: 2WS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l4pA (A:)
    msedyyekstvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihp
    kedfynfeatdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehi
    ktictryrdvvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklf
    yndynnempyklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslg
    leiqiteldisvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgis
    drhtwkdnfpvigrkdwpllfdidgkpkkaffriidflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l4pA (A:)
    tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
    tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
    vvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
    yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
    isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
    pvigrkdwpllfdidgkpkkaffriidf