PDB entry 4l4o

View 4l4o on RCSB PDB site
Description: The crystal structure of CbXyn10B in native form
Class: hydrolase
Keywords: GH10 family, xylanase, HYDROLASE
Deposited on 2013-06-08, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Caldicellulosiruptor bescii [TaxId:521460]
    Gene: Athe_0185
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9MMA5 (Start-336)
      • expression tag (337-338)
    Domains in SCOPe 2.06: d4l4oa1, d4l4oa2
  • Heterogens: 144, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l4oA (A:)
    msedyyekstvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihp
    kedfynfeatdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehi
    ktictryrdvvyswdvvneavedktdvllrdskwrriigddyikiafeiakkytgngklf
    yndynnempyklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslg
    leiqiteldisvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgis
    drhtwkdnfpvigrkdwpllfdidgkpkkaffriidflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l4oA (A:)
    tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
    tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
    vvyswdvvneavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
    yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
    isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
    pvigrkdwpllfdidgkpkkaffriidfle