PDB entry 4l3m

View 4l3m on RCSB PDB site
Description: Structure of the endo-1,4-beta-mannanase from thermophilic fungus Rhizomucor miehei
Class: hydrolase
Keywords: mannanase, glycoside hydrolase family 5, HYDROLASE
Deposited on 2013-06-06, released 2014-06-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-mannanase
    Species: Rhizomucor miehei [TaxId:4839]
    Gene: Man5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l3ma_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l3mA (A:)
    assfvqtsgpqftldgkpfyfegtnayylmtsdqsnvkqvfsdmkslglpvvrtwlfnlg
    sdsvwfqqwdsssnkmvindnsdtglgridyiiqqaasqdikliftlnnnwedyggmdyy
    vknfggtyhddfytntemidsfkeyishvlnrensltgvkykddptifgweianeprcvg
    sgdfpassncsttvttawikeiseyiksidsnhlvavgdegffnrkgesdyeynggsgmd
    fdailalssidfgtfhlypeawskgtdsswsvqwikdhaaaqadadkpvimeeyglstda
    lrvaqypvwqgtvededlaadafwqiavpcstmdgfgicasdndiattvtnhadamakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l3mA (A:)
    sfvqtsgpqftldgkpfyfegtnayylmtsdqsnvkqvfsdmkslglpvvrtwlfnlgsd
    svwfqqwdsssnkmvindnsdtglgridyiiqqaasqdikliftlnnnwedyggmdyyvk
    nfggtyhddfytntemidsfkeyishvlnrensltgvkykddptifgweianeprcvgsg
    dfpassncsttvttawikeiseyiksidsnhlvavgdegffnrkgesdyeynggsgmdfd
    ailalssidfgtfhlypeawskgtdsswsvqwikdhaaaqadadkpvimeeyglstdalr
    vaqypvwqgtvededlaadafwqiavpcstmdgfgicasdndiattvtnhadamakk