PDB entry 4l2c

View 4l2c on RCSB PDB site
Description: X-ray structure of the C57R mutant of the iron superoxide dismutase from Pseudoalteromonas haloplanktis (crystal form I)
Class: oxidoreductase
Keywords: Superoxide dismutase, C57R mutant, OXIDOREDUCTASE
Deposited on 2013-06-04, released 2014-02-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84612 (0-191)
      • engineered mutation (56)
    Domains in SCOPe 2.04: d4l2ca1, d4l2ca2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84612 (0-191)
      • engineered mutation (56)
    Domains in SCOPe 2.04: d4l2cb1, d4l2cb2
  • Chain 'C':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84612 (0-191)
      • engineered mutation (56)
    Domains in SCOPe 2.04: d4l2cc1, d4l2cc2
  • Chain 'D':
    Compound: superoxide dismutase [fe]
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: sodB, PSHAa1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84612 (0-191)
      • engineered mutation (56)
    Domains in SCOPe 2.04: d4l2cd1, d4l2cd2
  • Heterogens: FE, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2cA (A:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2cB (B:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2cC (C:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4l2cD (D:)
    afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
    ggvfnnaaqiwnhtfywnslspngggaptgavadainakwgsfdafkealndkavnnfgs
    swtwlvkladgsldivntsnaatpltddgvtpiltvdlwehayyidyrnvrpdylkgfws
    lvnwefananfa