PDB entry 4l1k

View 4l1k on RCSB PDB site
Description: Crystal structure of D-alanine-D-alnine ligase from Xanthomonas oryzae pv. oryzae with AMPPNP
Class: ligase
Keywords: ligase
Deposited on 2013-06-03, released 2014-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: ddl, ddlA, XOO0352
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5H614 (38-End)
      • see remark 999 (18-37)
      • engineered mutation (343)
    Domains in SCOPe 2.06: d4l1ka1, d4l1ka2
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l1kA (A:)
    hhhhhhhssenlyfqghmrkirvglifggksaehevslqsarnildaldpqrfepvligi
    dkqgqwhvndpdsfllhaddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvf
    pivhgtlgedgslqgllrmanlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdr
    htaahadvdtliaqlglplfvkpanqgssvgvsqvrtadafaaalalalaydhkvlveaa
    vagreiecavlgnavphasvcgevvvhdafysyatkyisehgaeivipadidaqtqqriq
    qiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrgli
    trlielalerhtddqllrsavelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l1kA (A:)
    rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
    ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma
    nlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplf
    vkpanqgssvgvsqvrtadafaaalalalaydhkvlveaavagreiecavlgnavphasv
    cgevvveivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlp
    gftrisvypklwqasgldyrglitrlielalerhtddqll