PDB entry 4l11

View 4l11 on RCSB PDB site
Description: Structure of the C-linker/CNBHD of agERG channels
Class: metal transport
Keywords: CNBHD, CNBD, KCNH, cyclic nucleotide binding domain, ion transport, METAL TRANSPORT
Deposited on 2013-06-01, released 2013-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agap007709-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: AGAP007709, AgaP_AGAP007709, ERG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4l11a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l11A (A:)
    gamgsgtaryhtqmlrvrefirfhqipnplrqrleeyfqhawtytngidmnsvlkgfpec
    lqadiclhlnrnllnncsafeaaspgclralslkfktthappgdilvhkgdvltylyfia
    rgsieilkddvvmailgkddifgenpcihstlgksnsnvkaltycdlhkihrddlldvld
    lfpefydsfvnsleitynmrdeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l11A (A:)
    taryhtqmlrvrefirfhqipnplrqrleeyfqhawtytngidmnsvlkgfpeclqadic
    lhlnrnllnncsafeaaspgclralslkfktthappgdilvhkgdvltylyfiargsiei
    lkddvvmailgkddifgenpcihstlgksnsnvkaltycdlhkihrddlldvldlfpefy
    dsfvnsleitynmrdeeq