PDB entry 4l05

View 4l05 on RCSB PDB site
Description: Cu/Zn superoxide dismutase from Brucella abortus
Class: oxidoreductase
Keywords: superoxide dismutase, Brucella abortus, OXIDOREDUCTASE
Deposited on 2013-05-30, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Superoxide dismutase [Cu-Zn]
  Species: Brucella abortus [TaxId:235]
  Gene: sodC, BruAb2_0527
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15453 (0-153)
  Domains in SCOPe 2.06: d4l05a_
• Heterogens: CU1, CU, ZN, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4l05A (A:)
  esttvkmyealptgpgkevgtvviseapgglhfkvnmekltpgyhgfhvhenpscapgek
  dgkivpalaagghydpgnthhhlgpegdghmgdlprlsanadgkvsetvvaphlkklaei
  kqrslmvhvggdnysdkpeplggggarfacgvie