PDB entry 4kzv

View 4kzv on RCSB PDB site
Description: Structure of the carbohydrate-recognition domain of the C-type lectin mincle bound to trehalose
Class: carbohydrate-binding protein
Keywords: C-type lectin, carbohydrate-recognition domain, CARBOHYDRATE-BINDING PROTEIN
Deposited on 2013-05-30, released 2013-08-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.17
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin mincle
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • expression tag (0)
      • see remark 999 (96)
    Domains in SCOPe 2.03: d4kzva_
  • Chain 'B':
    Compound: C-type lectin mincle
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • expression tag (0)
      • see remark 999 (131)
    Domains in SCOPe 2.03: d4kzvb_
  • Heterogens: TRE, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kzvA (A:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kzvA (A:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcempe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kzvB (B:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kzvB (B:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnndcatirdssnprqnwndvpcffnmfr
    vcemper