PDB entry 4kzn

View 4kzn on RCSB PDB site
Description: crystal structure of human VEGF-A receptor binding domain
Class: hormone
Keywords: VEGF A, PDGF family, receptor binding, HORMONE
Deposited on 2013-05-30, released 2014-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kzna_
  • Heterogens: NAG, FUC, BMA, MAN, PGE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kznA (A:)
    shhhhhhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeg
    lecvpteesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kznA (A:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk