PDB entry 4kze

View 4kze on RCSB PDB site
Description: Crystal structure of an RNA aptamer in complex with Fab
Class: immune system/rna
Keywords: G-quadruplex, Fluorescence, Fluorophore binding, immune system-rna complex
Deposited on 2013-05-29, released 2014-06-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: BL3-6 Fab antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KZE
  • Chain 'L':
    Compound: BL3-6 Fab antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KZE (0-214)
    Domains in SCOPe 2.06: d4kzel1, d4kzel2
  • Chain 'R':
    Compound: RNA (84-mer)
  • Heterogens: K, MG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kzeL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqsysfpstfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'R':
    No sequence available.