PDB entry 4kza

View 4kza on RCSB PDB site
Description: Crystal structure of AmpC beta-lactamase in complex with fragment 48 (3-(cyclopropylsulfamoyl)thiophene-2-carboxylic acid)
Class: hydrolase/hydrolase inhibitor
Keywords: AMPC beta-lactamase, class C, hydrolase, cephalosporinase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-05-29, released 2014-05-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampA, ampC, b4150, JW4111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kzaa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampA, ampC, b4150, JW4111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kzab_
  • Heterogens: NZ9, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kzaA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kzaB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq