PDB entry 4kz1

View 4kz1 on RCSB PDB site
Description: Crystal structure of the soluble domain of VirB8 from Bartonella grahamii
Class: protein transport
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, type IV secretion sequence, host-specific pathogen, Trw family, immune response, cell adhesion, weak dimer, PROTEIN TRANSPORT
Deposited on 2013-05-29, released 2014-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: VirB8 protein
  Species: Bartonella grahamii [TaxId:634504]
  Gene: Bgr_14870, virB8
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6AER9
  Domains in SCOPe 2.08: d4kz1a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4kz1A (A:)
  mahhhhhhmaltplktvepfvirvdnstgiidtvsalkespndydeaitryfasqyvrar
  egfqaseaennfrlvsllsspkeqnrfgkwyagnnpespqniyhnmiatvtiksisfisk
  dliqvryyktvrdfnekenishwisilnfsyvnahistsdrlinplgfqvseyrsdpevi
  k
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4kz1A (A:)
  ydeaitryfasqyvraregfqaseaennfrlvsllsspkeqnrfgkwyagnnpespqniy
  hnmiatvtiksisfiskdliqvryyktvrdfnekenishwisilnfsyvnahistsdrli
  nplgfqvseyrsdpe